PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678360445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 314aa    MW: 34800.4 Da    PI: 4.7859
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678360445genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.4e-092412762055
                HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                +k +yps++++  LA+++gL+++q+ +WF N+R ++
  678360445 241 YKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 276
                5679*****************************885 PP

2ELK422e-14196217122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK+qLl+KYsgyLg+LkqEF+
  678360445 196 ELKNQLLQKYSGYLGGLKQEFM 217
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.7E-1560104IPR005540KNOX1
PfamPF037901.0E-1763100IPR005540KNOX1
SMARTSM012568.7E-19106157IPR005541KNOX2
PfamPF037912.0E-19111156IPR005541KNOX2
PfamPF037892.4E-11196217IPR005539ELK domain
PROSITE profilePS5121311.331196216IPR005539ELK domain
SMARTSM011881.5E-7196217IPR005539ELK domain
PROSITE profilePS5007112.422216279IPR001356Homeobox domain
SuperFamilySSF466892.1E-17218288IPR009057Homeodomain-like
SMARTSM003898.4E-11218283IPR001356Homeobox domain
CDDcd000861.02E-13219280No hitNo description
Gene3DG3DSA:1.10.10.603.0E-26221282IPR009057Homeodomain-like
PfamPF059205.3E-17236275IPR008422Homeobox KN domain
PROSITE patternPS000270254277IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MDCGNDAIMF AFGEAANTPM MMIVPEICGG SQPDTACAAA NNTLFPNPMI HGGYPYFNHE  60
EDKAKIMAHP QFHRLLSAYA NCQKIGAPSE VAAKLDETAE MMNRGASCSS CSDPALDQFM  120
EAYCEMLIKY EQEITKPLKE AVAFLSTVES QLSFLTFSGL SSSSFSASRE LDASSSLEGG  180
LGASGAMIDP QAEESELKNQ LLQKYSGYLG GLKQEFMKKT KKEKLPRDAR QQLLEWWSRH  240
YKWPYPSESQ KLALAESTGL DQKQINNWFI NQRKRHWRPS EEMQYVVMEA AQPGFMTADD  300
MLAAGGGDTF PGML
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010645351.11e-106PREDICTED: homeobox protein SBH1
RefseqXP_002271944.11e-106PREDICTED: homeobox protein SBH1
SwissprotP466081e-102HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLF6HRE41e-106F6HRE4_VITVI; Putative uncharacterized protein
STRINGVIT_10s0116g00190.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.15e-87KNOX/ELK homeobox transcription factor